Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1; human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related ; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor
Species
Homo sapiens (Human)
Expression Region
1-598aa
Target Protein Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene fragment corresponding to the 1-598aa of the human NR4A2 protein was synthesized, with appropriate restriction sites suitable for in-frame cloning into an expression vector, with N-terminal 6xHis tag. The yeast was transfected with the expression vector, and the clone was expressed upon certain induction. After the induced cell centrifugation, the recombinant protein was purified from the cell extract and presented as N-terminal 6xHis-tagged fusion. This recombinant human NR4A2 protein's purity is greater than 90% assayed by SDS-PAGE. The NR4A2 protein ran to a band of about 55 kDa molecular weight on the gel.
Nuclear Receptor 4A2 (NR4A2/NURR1) belongs to the member of the steroid-thyroid hormone-retinoid receptor superfamily. NR4A2 mutations can cause intellectual disability and language impairment with persistent Dystonia-Parkinsonism. In addition, NR4A2 regulates autophagy and chemoresistance in pancreatic ductal adenocarcinoma. Also, misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. De novo variants of NR4A2 are associated with neurodevelopmental disorder and epilepsy. Genome-Wide analysis identifies NURR1-Controlled network of new synapse formation and cell cycle arrest in human neural stem cells.